Can I use this publicly available dataset to build commercial AI software? -- A Case Study on Publicly Available Image Datasets

Quick Summary:

This paper proposes a new method to evaluate potential license compliance violations when using publicly available datasets for commercial AI software. The study finds significant risks of violations when employing six commonly used image datasets for commercial purposes due to unclear dataset licensing terms.

Share: Share on X Share on Facebook Share on LinkedIn

arXiv Id: 2111.02374

Comments: This is revised version of the paper with updated co-authors

Date Published: 2022-04-12

Date Updated: 2022-04-12

Key Terms (TF-IDF):

publicly available (0.300)

violations (0.283)

commercial (0.283)

publicly (0.282)

commercial (0.274)

publicly available (0.270)

publicly (0.266)

dataset (0.244)

dataset (0.234)

software (0.220)

software (0.209)

outline (0.200)

datasets (0.198)

available (0.193)

datasets (0.193)

ai (0.192)

ai (0.189)

available (0.182)

used (0.143)

checking (0.140)

License: http://creativecommons.org/licenses/by-nc-nd/4.0/

Summary:

Publicly available datasets are one of the key drivers for commercial AI software. The use of publicly available datasets is governed by dataset licenses. These dataset licenses outline the rights one is entitled to on a given dataset and the obligations that one must fulfil to enjoy such rights without any license compliance violations. Unlike standardized Open Source Software (OSS) licenses, existing dataset licenses are defined in an ad-hoc manner and do not clearly outline the rights and obligations associated with their usage. Further, a public dataset may be hosted in multiple locations and created from multiple data sources each of which may have different licenses. Hence, existing approaches on checking OSS license compliance cannot be used. In this paper, we propose a new approach to assessing the potential license compliance violations if a given publicly available dataset were to be used for building commercial AI software. We conduct a case study with our approach on 6 commonly used publicly available image datasets. Our results show that there exists potential risks of license violations associated with all of the studied datasets if they were used for commercial purposes.

Citation & Reference Network Visualization

This graph shows how this paper is connected to other research. The current paper is shown in dark gray, papers that cite it are in green, and papers it references are in blue. You can:

Current Paper

Papers citing this work (Citations)

Papers cited by this work (References)

• Hover over any node to see the paper title

• Click a node to view that paper's details

• Drag nodes to rearrange the graph

• Use the zoom controls (bottom right) to zoom in/out

Citations and References

Title	Authors	Year	Actions
Do Not Trust Licenses You See -- Dataset Compliance Requires Massive-Scale AI-Powered Lifecycle Tracing	Jaekyeom Kim, Sungryull Sohn, Gerrard Jeongwon Jo, Jihoon Choi, Kyunghoon Bae, Hwayoung Lee, Yongmin Park, Ho-Sun Lee	2025	View Paper
"They've Stolen My GPL-Licensed Model!": Toward Standardized and Transparent Model Licensing	Moming Duan, Rui Zhao, Linshan Jiang, Nigel Shadbolt, Bingsheng He	2024	View Paper
Benchmark Data Repositories for Better Benchmarking	Rachel Longjohn, Markelle Kelly, Sameer Singh, Padhraic Smyth	2024	View Paper
Rethinking Software Engineering in the Era of Foundation Models: A Curated Catalogue of Challenges in the Development of Trustworthy FMware	Ahmed E. Hassan, Dayi Lin, Gopi Krishnan Rajbahadur, Keheliya Gallaba, F. Côgo, Boyuan Chen, Haoxiang Zhang, Kishanthan Thangarajah, G. Oliva, Jiahuei Lin, Wali Mohammad Abdullah, Zhen Ming Jiang	2024	View Paper
SimClone: Detecting Tabular Data Clones using Value Similarity	Xu Yang, Gopi Krishnan Rajbahadur, Dayi Lin, Shaowei Wang, Zhen Ming Jiang	2024	View Paper
ModelGo: A Practical Tool for Machine Learning License Analysis	Moming Duan, Q. Li, Bingsheng He	2024	View Paper
Rethinking Software Engineering in the Foundation Model Era: A Curated Catalogue of Challenges in the Development of Trustworthy FMware	Ahmed E. Hassan, Dayi Lin, Gopi Krishnan Rajbahadur, Keheliya Gallaba, F. Côgo, Boyuan Chen, Haoxiang Zhang, Kishanthan Thangarajah, G. Oliva, Jiahuei Lin, Wali Mohammad Abdullah, Zhen Ming Jiang	2024	View Paper

Title	Authors	Year	Actions
Ethics Guidelines for Trustworthy AI	M. Cannarsa	2021	View Paper
Mitigating dataset harms requires stewardship: Lessons from 1000 papers	Kenny Peng, Arunesh Mathur, Arvind Narayanan	2021	View Paper
What makes a popular academic AI repository?	Yuanrui Fan, Xin Xia, David Lo, Ahmed E. Hassan, Shanping Li	2020	View Paper
A survey on Image Data Augmentation for Deep Learning	Connor Shorten, T. Khoshgoftaar	2019	View Paper
Towards Standardization of Data Licenses: The Montreal Data License	Misha Benjamin, P. Gagnon, Negar Rostamzadeh, C. Pal, Yoshua Bengio, Alex Shee	2019	View Paper
A Style-Based Generator Architecture for Generative Adversarial Networks	Tero Karras, S. Laine, Timo Aila	2018	View Paper
A Marketplace for Data: An Algorithmic Solution	Anish Agarwal, M. Dahleh, Tuhin Sarkar	2018	View Paper
VGGFace2: A Dataset for Recognising Faces across Pose and Age	Qiong Cao, Li Shen, Weidi Xie, Omkar M. Parkhi, Andrew Zisserman	2017	View Paper
Machine Learning Models that Remember Too Much	Congzheng Song, Thomas Ristenpart, Vitaly Shmatikov	2017	View Paper
Automating the license compatibility process in open source software with SPDX	G. Kapitsaki, Frederik Kramer, Nikolaos D. Tselikas	2017	View Paper
Analysis of license inconsistency in large collections of open source projects	Yuhao Wu, Yuki Manabe, Tetsuya Kanda, D. Germán, Katsuro Inoue	2016	View Paper
Data Ownership and Access to Data - Position Statement of the Max Planck Institute for Innovation and Competition of 16 August 2016 on the Current European Debate	Josef Drexl, Josef Drexl, Reto M. Hilty, Reto M. Hilty, Reto M. Hilty, Luc Desaunettes-Barbero, Luc Desaunettes-Barbero, Franziska Greiner, Daria Kim, Heiko Richter, Gintarė Surblytė, Klaus Wiedemann	2016	View Paper
A Method to Detect License Inconsistencies in Large-Scale Open Source Projects	Yuhao Wu, Yuki Manabe, Tetsuya Kanda, D. Germán, Katsuro Inoue	2015	View Paper
Tracing software build processes to uncover license compliance inconsistencies	S. V. D. Burg, E. Dolstra, Shane McIntosh, Julius Davies, D. Germán, Armijn Hemel	2014	View Paper
ImageNet Large Scale Visual Recognition Challenge	Olga Russakovsky, Jia Deng, Hao Su, J. Krause, S. Satheesh, Sean Ma, Zhiheng Huang, A. Karpathy, A. Khosla, Michael S. Bernstein, A. Berg, Li Fei-Fei	2014	View Paper
The role of legal expertise in interpretation of legal requirements and definitions	David G. Gordon, T. Breaux	2014	View Paper
Data Augmentation for deep neural network acoustic modeling	Xiaodong Cui, Vaibhava Goel, Brian Kingsbury	2014	View Paper
Microsoft COCO: Common Objects in Context	Tsung-Yi Lin, M. Maire, Serge J. Belongie, James Hays, P. Perona, Deva Ramanan, Piotr Dollár, C. L. Zitnick	2014	View Paper
GaiusT: supporting the extraction of rights and obligations for regulatory compliance	Nicola Zeni, Nadzeya Kiyavitskaya, Luisa Mich, J. Cordy, J. Mylopoulos	2013	View Paper
Arguing regulatory compliance of software requirements	Silvia Ingolfo, A. Siena, J. Mylopoulos, A. Susi, A. Perini	2013	View Paper
A Method for Open Source License Compliance of Java Applications	D. Germán, M. D. Penta	2012	View Paper
Automatic checking of license compliance	Hongyu Zhang, Bei Shi, Lu Zhang	2010	View Paper
License integration patterns: Addressing license mismatches in component-based development	D. Germán, A. Hassan	2009	View Paper
80 Million Tiny Images: A Large Data Set for Nonparametric Object and Scene Recognition	Antonio Torralba, Rob Fergus, William T. Freeman	2008	View Paper
Automating the Extraction of Rights and Obligations for Regulatory Compliance	Nadzeya Kiyavitskaya, Nicola Zeni, T. Breaux, A. Antón, J. Cordy, Luisa Mich, J. Mylopoulos	2008	View Paper
Legal Requirements, Compliance and Practice: An Industry Case Study in Accessibility	T. Breaux, A. Antón, K. Boucher, M. Dorfman	2008	View Paper
Guide	Y. Danieli	2005	View Paper
The Internet Archive Wayback Machine	Sarah L. Nesbeitt	2002	View Paper
Can I use this publicly available dataset to build commercial AI software?-A Case Study on Publicly Available Image Datasets	Zhen Ming	2022	View Paper
Papers with Code		2021
Laying Down Harmonised Rules on Artifical Intelligence (Artificial Intelligence Act) and Amending Certain Union Legislative Acts		2021
GluonCV YOLOv3 Object Detector		2021
Kaggle		2021
TensorFlow Hub		2021
The CIFAR-10 dataset. https://www.cs.toronto.edu/~kriz/cifar.html [Last visited on 09-22-2021		2021
Popular Datasets Over Time		2021
A guide to copyright		2021
Microsoft’s GitHub Copilot Met with Backlash from Open Source Copyright Advocates		2021
GitHub Copilot: Your AI pair programmer		2021
Submission of the Office of the Privacy Commissioner of Canada on Bill C-11, the Digital Charter Implementation Act, 2020.		2021
Infringement of Copyright and Moral Rights and Exceptions to Infringement (continued		2021
GitHub’s automatic coding tool rests on untested legal ground		2021
Image Classification Model by Modzy		2021
GitHub Copilot is not infringing your copyright		2021
Datasets for machine learning		2021
Asurveyofprivacyattacksinmachinelearning		2020
Florida Medical Record Disclosure Law Preempted by Health Insurance Portability and Accountability Act of 1996 (HIPAA)	J. Geetter, James A. Saling, M. Wil	2019	View Paper
Hype Cycle for Artificial Intelligence		2019
The Data that Transformed AI Research—and Possibly the World		2017
The Cityscapes Dataset	Marius Cordts, Mohamed Omran, Sebastian Ramos, Timo Scharwächter, Markus Enzweiler, Rodrigo Benenson, Uwe Franke, S. Roth, B. Schiele	2015	View Paper
Understanding software artifact provenance	Michael W. Godfrey	2015	View Paper
The Authors Guild v. Google		2015
Multi-domain master data management: Advanced MDM and data governance in practice		2015
Study on the legal framework of text and data mining (TDM)		2014
Learning Multiple Layers of Features from Tiny Images	A. Krizhevsky	2009	View Paper
Analyzing Regulatory Rules for Privacy and Security Requirements	T. Breaux, A. Antón	2008	View Paper
Tiny images	R. Fergus, W. Freeman	2007	View Paper
2021. deeplabv3-mobilenetv3-cityscapes: Lightweight deep learning model for semantic image segmentation
recording Rights to dataset in conjunction with AI models
Rajbahadur
The MDL does not record the obligations that the user of a dataset needs to fulfil when enjoying a specific right

Can I use this publicly available dataset to build commercial AI software? -- A Case Study on Publicly Available Image Datasets

Quick Summary:

Categories:

Key Terms (TF-IDF):

Summary:

Citation & Reference Network Visualization

Citations and References

Similar Papers

LicenseGPT: A Fine-tuned Foundation Model for Publicly Available Dataset License Compliance

Does Speech enhancement of publicly available data help build robust Speech Recognition Systems?

Exploring Adult Glioma through MRI: A Review of Publicly Available Datasets to Guide Efficient Image Analysis

Copycats: the many lives of a publicly available medical imaging dataset

Comments (0)

Replies (0)

Add a Tag

Confirm Tag Removal

Edit Tag