OC-NMN: Object-centric Compositional Neural Module Network for Generative Visual Analogical Reasoning

Quick Summary:

The OC-NMN framework decomposes visual generative reasoning tasks into modular components, enabling compositionally augmented training and improving out-of-distribution generalization, demonstrated through its performance on a visual reasoning benchmark involving arithmetic operations on MNIST digits.

Share: Share on X Share on Facebook Share on LinkedIn

Authors:

arXiv Id: 2310.18807

Date Published: 2023-10-31

Date Updated: 2023-10-31

Key Terms (TF-IDF):

reasoning (0.319)

visual (0.268)

tasks (0.176)

attained (0.167)

data augmentation (0.162)

arithmetic (0.157)

augmentation (0.152)

choices (0.151)

aspect (0.151)

baselines (0.147)

new (0.145)

modular (0.144)

intelligence (0.141)

concepts (0.139)

capacity (0.138)

generative (0.137)

operations (0.136)

learned (0.134)

ways (0.133)

inspired (0.133)

License: http://arxiv.org/licenses/nonexclusive-distrib/1.0/

Summary:

A key aspect of human intelligence is the ability to imagine -- composing learned concepts in novel ways -- to make sense of new scenarios. Such capacity is not yet attained for machine learning systems. In this work, in the context of visual reasoning, we show how modularity can be leveraged to derive a compositional data augmentation framework inspired by imagination. Our method, denoted Object-centric Compositional Neural Module Network (OC-NMN), decomposes visual generative reasoning tasks into a series of primitives applied to objects without using a domain-specific language. We show that our modular architectural choices can be used to generate new training tasks that lead to better out-of-distribution generalization. We compare our model to existing and new baselines in proposed visual reasoning benchmark that consists of applying arithmetic operations to MNIST digits.

Citation & Reference Network Visualization

This graph shows how this paper is connected to other research. The current paper is shown in dark gray, papers that cite it are in green, and papers it references are in blue. You can:

Current Paper

Papers citing this work (Citations)

Papers cited by this work (References)

• Hover over any node to see the paper title

• Click a node to view that paper's details

• Drag nodes to rearrange the graph

• Use the zoom controls (bottom right) to zoom in/out

Citations and References

No citations found for this paper.

Title	Authors	Year	Actions
The ConceptARC Benchmark: Evaluating Understanding and Generalization in the ARC Domain	A. Moskvichev, Victor Vikram Odouard, Melanie Mitchell	2023	View Paper
Emergent analogical reasoning in large language models	Taylor W. Webb, K. Holyoak, Hongjing Lu	2022	View Paper
Scaling Instruction-Finetuned Language Models	Hyung Won Chung, Le Hou, S. Longpre, Barret Zoph, Yi Tay, W. Fedus, Eric Li, Xuezhi Wang, Mostafa Dehghani, Siddhartha Brahma, Albert Webson, S. Gu, Zhuyun Dai, Mirac Suzgun, Xinyun Chen, Aakanksha Chowdhery, Dasha Valter, Sharan Narang, Gaurav Mishra, Adams Wei Yu, Vincent Zhao, Yanping Huang, Andrew M. Dai, Hongkun Yu, Slav Petrov, Ed H. Chi, J. Dean, Jacob Devlin, Adam Roberts, Denny Zhou, Quoc V. Le, Jason Wei	2022	View Paper
Improving Systematic Generalization Through Modularity and Augmentation	Laura Ruis, B. Lake	2022	View Paper
Continual Learning via Local Module Composition	O. Ostapenko, Pau Rodríguez López, Massimo Caccia, Laurent Charlin	2021	View Paper
DreamCoder: bootstrapping inductive program synthesis with wake-sleep library learning	Kevin Ellis, Catherine Wong, Maxwell Nye, Mathias Sablé-Meyer, Lucas Morales, Luke B. Hewitt, Luc Cary, Armando Solar-Lezama, J. Tenenbaum	2021	View Paper
Neural Production Systems	Anirudh Goyal, Aniket Didolkar, Nan Rosemary Ke, C. Blundell, Philippe Beaudoin, N. Heess, M. Mozer, Y. Bengio	2021	View Paper
Abstraction and analogy‐making in artificial intelligence	M. Mitchell	2021	View Paper
Emergent Symbols through Binding in External Memory	Taylor W. Webb, I. Sinha, J. Cohen	2020	View Paper
Inductive biases for deep learning of higher-level cognition	Anirudh Goyal, Yoshua Bengio	2020	View Paper
Neural Abstract Reasoner	Victor Kolev, B. Georgiev, Svetlin Penkov	2020	View Paper
Mastering Atari with Discrete World Models	Danijar Hafner, T. Lillicrap, Mohammad Norouzi, Jimmy Ba	2020	View Paper
Improving Generative Imagination in Object-Centric World Models	Zhixuan Lin, Yi-Fu Wu, Skand Peri, Bofeng Fu, Jindong Jiang, Sungjin Ahn	2020	View Paper
The overfitted brain: Dreams evolved to assist generalization	Erik P. Hoel	2020	View Paper
Object Files and Schemata: Factorizing Declarative and Procedural Knowledge in Dynamical Systems	Anirudh Goyal, Alex Lamb, Phanideep Gampa, Philippe Beaudoin, S. Levine, C. Blundell, Yoshua Bengio, M. Mozer	2020	View Paper
Object-Centric Learning with Slot Attention	Francesco Locatello, Dirk Weissenborn, Thomas Unterthiner, Aravindh Mahendran, G. Heigold, Jakob Uszkoreit, Alexey Dosovitskiy, Thomas Kipf	2020	View Paper
Closed Loop Neural-Symbolic Learning via Integrating Neural Perception, Grammar Parsing, and Symbolic Reasoning	Qing Li, Siyuan Huang, Yining Hong, Yixin Chen, Y. Wu, Song-Chun Zhu	2020	View Paper
CLOSURE: Assessing Systematic Generalization of CLEVR Models	Dzmitry Bahdanau, H. D. Vries, Timothy J. O'Donnell, Shikhar Murty, Philippe Beaudoin, Yoshua Bengio, Aaron C. Courville	2019	View Paper
Dream to Control: Learning Behaviors by Latent Imagination	Danijar Hafner, T. Lillicrap, Jimmy Ba, Mohammad Norouzi	2019	View Paper
Recurrent Independent Mechanisms	Anirudh Goyal, Alex Lamb, Jordan Hoffmann, Shagun Sodhani, S. Levine, Yoshua Bengio, B. Scholkopf	2019	View Paper
Spatially Invariant Unsupervised Object Detection with Convolutional Neural Networks	Eric Crawford, Joelle Pineau	2019	View Paper
Invariant Risk Minimization	Martín Arjovsky, L. Bottou, Ishaan Gulrajani, David Lopez-Paz	2019	View Paper
A Perspective on Objects and Systematic Generalization in Model-Based RL	Sjoerd van Steenkiste, Klaus Greff, J. Schmidhuber	2019	View Paper
Faster Attend-Infer-Repeat with Tractable Probabilistic Models	Karl Stelzner, Robert Peharz, K. Kersting	2019	View Paper
RAVEN: A Dataset for Relational and Analogical Visual REasoNing	Chi Zhang, Feng Gao, Baoxiong Jia, Yixin Zhu, Song-Chun Zhu	2019	View Paper
Multi-Object Representation Learning with Iterative Variational Inference	Klaus Greff, Raphael Lopez Kaufman, Rishabh Kabra, Nicholas Watters, Christopher P. Burgess, Daniel Zoran, L. Matthey, M. Botvinick, Alexander Lerchner	2019	View Paper
A Meta-Transfer Objective for Learning to Disentangle Causal Mechanisms	Yoshua Bengio, T. Deleu, Nasim Rahaman, Nan Rosemary Ke, Sébastien Lachapelle, O. Bilaniuk, Anirudh Goyal, C. Pal	2019	View Paper
MONet: Unsupervised Scene Decomposition and Representation	Christopher P. Burgess, L. Matthey, Nicholas Watters, Rishabh Kabra, I. Higgins, M. Botvinick, Alexander Lerchner	2019	View Paper
ImageNet-trained CNNs are biased towards texture; increasing shape bias improves accuracy and robustness	Robert Geirhos, Patricia Rubisch, Claudio Michaelis, M. Bethge, Felix Wichmann, Wieland Brendel	2018	View Paper
Building Machines that Learn and Think Like People	J. Tenenbaum	2018	View Paper
Measuring abstract reasoning in neural networks	Adam Santoro, Felix Hill, D. Barrett, Ari S. Morcos, T. Lillicrap	2018	View Paper
Sequential Attend, Infer, Repeat: Generative Modelling of Moving Objects	Adam R. Kosiorek, Hyunjik Kim, I. Posner, Y. Teh	2018	View Paper
Relational Neural Expectation Maximization: Unsupervised Discovery of Objects and their Interactions	Sjoerd van Steenkiste, Michael Chang, Klaus Greff, J. Schmidhuber	2018	View Paper
Exploring the Landscape of Spatial Robustness	Logan Engstrom, Brandon Tran, Dimitris Tsipras, Ludwig Schmidt, A. Madry	2017	View Paper
Learning Independent Causal Mechanisms	Giambattista Parascandolo, Mateo Rojas-Carulla, Niki Kilbertus, B. Scholkopf	2017	View Paper
What is consciousness, and could machines have it?	S. Dehaene, H. Lau, S. Kouider	2017	View Paper
One Pixel Attack for Fooling Deep Neural Networks	Jiawei Su, Danilo Vasconcellos Vargas, K. Sakurai	2017	View Paper
IQ of Neural Networks	Dokhyam Hoshen, M. Werman	2017	View Paper
Making Neural Programming Architectures Generalize via Recursion	Jonathon Cai, Richard Shin, D. Song	2017	View Paper
Neural Expectation Maximization	Klaus Greff, Sjoerd van Steenkiste, J. Schmidhuber	2017	View Paper
Hybrid computing using a neural network with dynamic external memory	Alex Graves, Greg Wayne, Malcolm Reynolds, Tim Harley, Ivo Danihelka, A. Grabska-Barwinska, Sergio Gomez Colmenarejo, Edward Grefenstette, Tiago Ramalho, J. Agapiou, Adrià Puigdomènech Badia, Karl Moritz Hermann, Yori Zwols, Georg Ostrovski, Adam Cain, Helen King, C. Summerfield, Phil Blunsom, K. Kavukcuoglu, D. Hassabis	2016	View Paper
Attend, Infer, Repeat: Fast Scene Understanding with Generative Models	S. Eslami, N. Heess, T. Weber, Yuval Tassa, David Szepesvari, K. Kavukcuoglu, Geoffrey E. Hinton	2016	View Paper
Neural Programmer-Interpreters	Scott E. Reed, Nando de Freitas	2015	View Paper
Neural Module Networks	Jacob Andreas, Marcus Rohrbach, Trevor Darrell, D. Klein	2015	View Paper
A measure of intelligence	A. Tate	2012	View Paper
A Fast Learning Algorithm for Deep Belief Nets	Geoffrey E. Hinton, Simon Osindero, Y. Teh	2006	View Paper
Connectionism and cognitive architecture: A critical analysis	J. Fodor, Z. Pylyshyn	1988	View Paper
Instructions for	Masakazu Suzuki, Susumu Hyodo, A. Urano, ZS9157-167.pdf, Susumu Hyodo1, Ser, He, Ala Leu, Ala Phe, Pro Ser, Lys, Asp, Arg, Asn, Mpystfqllwvlgllalssa Cyiqncpeg, Gkr SFPDL-P-RQ, Mpdstipllcvlgllalssa Cyiqncprg, Gkr SFPDL-K-RP, Mamfgtsvsalcllfllsvcta Cyisncpig, Gkr SALAF-PSRK, MSYTAL-AVTFFGWLALSSA Cyiqncpig, Gkr Svidfmdvrk, CLPCGPGGKGRCLGPSICCADELGCFVGTAEALRCQEENYLPSPCQSGQK, CIPCGPGNRGNCFGPNICCGEDLGCYVGTPETLRCVEETYLPSPCEAGGK, CMSCGPGDRGRCFGPNICCGEGMGCYHGSPEAAGCVEENYLPSPCEAGGR, CMACGPGDRGRCFGPNICCGEGMGCYVGSPEAAGCVEENYLPSPCEAGGR, R. VTP-EQNMTQMDGSASDLLLRLMHMANRQQQSKHQFY, Vf, t-proMT SCTMDPAC-EQDSVFS	2023	View Paper
Systematic generalization: What is required and can it be learned?		2018
A method for stochastic optimization		2014
Core knowledge.	E. Spelke, Katherine D. Kinzler	2007	View Paper
IN THE THEATRE OF CONSCIOUSNESS Global Workspace Theory, A Rigorous Scientific Theory of Consciousness.	B. Baars	1997	View Paper
mental tests used in genetic studies: The performance of related individuals on tests mainly ed-ucative and mainly reproductive		1936
Causality : Models , Reasoning , and Inference			View Paper

OC-NMN: Object-centric Compositional Neural Module Network for Generative Visual Analogical Reasoning

Quick Summary:

Authors:

Categories:

Key Terms (TF-IDF):

Summary:

Citation & Reference Network Visualization

Citations and References

Similar Papers

Meta Module Network for Compositional Visual Reasoning

Multimodal Representations for Teacher-Guided Compositional Visual Reasoning

Visual Reasoning in Object-Centric Deep Neural Networks: A Comparative Cognition Approach

Object-Centric Diagnosis of Visual Reasoning

Comments (0)

Replies (0)

Add a Tag

Confirm Tag Removal

Edit Tag